CDS

Accession Number TCMCG047C05130
gbkey CDS
Protein Id GFP83695.1
Location 2063847..2064155
Organism Phtheirospermum japonicum
locus_tag PHJA_000513000

Protein

Length 102aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB3858 BioSample:SAMD00029051
db_source BMAC01000068.1
Definition NAC domain-containing protein 7 [Phtheirospermum japonicum]
Locus_tag PHJA_000513000

EGGNOG-MAPPER Annotation

COG_category K
Description Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'- (T A)NN(C T)(T C G)TNNNNNNNA(A C)GN(A C T)(A T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE -
KEGG_ko -
EC -
KEGG_Pathway -
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003677        [VIEW IN EMBL-EBI]
GO:0003700        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009888        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010087        [VIEW IN EMBL-EBI]
GO:0010089        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0030154        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0032502        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043565        [VIEW IN EMBL-EBI]
GO:0044087        [VIEW IN EMBL-EBI]
GO:0044089        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0048518        [VIEW IN EMBL-EBI]
GO:0048522        [VIEW IN EMBL-EBI]
GO:0048759        [VIEW IN EMBL-EBI]
GO:0048856        [VIEW IN EMBL-EBI]
GO:0048869        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1901348        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1903338        [VIEW IN EMBL-EBI]
GO:1903340        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:1905177        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2000652        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCAGGGTTTTGGAAGGCTACCAGAAGAGATAAAGAGGTCTATGACAGATCCCAACTCATCGGCATGAGGAATACACTCGTATTCTACAAAGGAAGAGCACCAAATGGGGAGAAAACTGACTGGATCATGCATGAATACAGGCTTGAATCTGAAGAGAATGGTCCTCCACAGGCATGCTTCTTTATTTATATCTTTTATAGTTCTTCAAAATATCTTAATCTTTATAATTTTATTTTATTTTTTCTTCCTTCTTCTATCGGTTTTCTTCGGAAAATTTCCCCCAATCGGGACTCAGGCCCGAAGTAG
Protein:  
MAGFWKATRRDKEVYDRSQLIGMRNTLVFYKGRAPNGEKTDWIMHEYRLESEENGPPQACFFIYIFYSSSKYLNLYNFILFFLPSSIGFLRKISPNRDSGPK